BAY 55-9837
SMILES | None |
InChIKey | XALJYDFLMDKOLY-ZBLLYJRDSA-N |
Sequence | HSDAVFTDNYTRLRKQVAAKKYLQSIKNKRY |
Chemical properties
Hydrogen bond acceptors | None |
Hydrogen bond donors | None |
Rotatable bonds | None |
Molecular weight (Da) |
Drug properties
Molecular type | Peptide |
Endogenous/Surrogate | Surrogate |
Approved drug | No |
Database connections
Bioactivities
Receptor | Activity | Source | |||||||
---|---|---|---|---|---|---|---|---|---|
GTP | Uniprot | Species | Family | Class | Type | Min | Avg | Max | Database |
VPAC2 | VIPR2 | Human | VIP and PACAP | B1 | pKd | 9.2 | 9.2 | 9.2 | Guide to Pharmacology |
Receptor | Activity | Source | |||||||
---|---|---|---|---|---|---|---|---|---|
GTP | Uniprot | Species | Family | Class | Type | Min | Avg | Max | Database |
PAC1 | PACR | Human | VIP and PACAP | B1 | pIC50 | 5.0 | 5.0 | 5.0 | Guide to Pharmacology |
VPAC1 | VIPR1 | Human | VIP and PACAP | B1 | pEC50 | 7.0 | 7.0 | 7.0 | Guide to Pharmacology |
VPAC1 | VIPR1 | Human | VIP and PACAP | B1 | pIC50 | 5.1 | 5.1 | 5.1 | Guide to Pharmacology |
VPAC2 | VIPR2 | Human | VIP and PACAP | B1 | pEC50 | 9.4 | 9.4 | 9.4 | Guide to Pharmacology |
VPAC2 | VIPR2 | Human | VIP and PACAP | B1 | pIC50 | 7.2 | 7.2 | 7.2 | Guide to Pharmacology |