BAY 55-9837


SMILES None
InChIKey XALJYDFLMDKOLY-ZBLLYJRDSA-N
Sequence HSDAVFTDNYTRLRKQVAAKKYLQSIKNKRY

Chemical properties

Hydrogen bond acceptors None
Hydrogen bond donors None
Rotatable bonds None
Molecular weight (Da)

Drug properties

Molecular type Peptide
Endogenous/Surrogate Surrogate
Approved drug No

Bioactivities

Receptor Activity Source
GTP Uniprot Species Family Class Type Min Avg Max Database
VPAC2 VIPR2 Human VIP and PACAP B1 pKd 9.2 9.2 9.2 Guide to Pharmacology
Receptor Activity Source
GTP Uniprot Species Family Class Type Min Avg Max Database
PAC1 PACR Human VIP and PACAP B1 pIC50 5.0 5.0 5.0 Guide to Pharmacology
VPAC1 VIPR1 Human VIP and PACAP B1 pEC50 7.0 7.0 7.0 Guide to Pharmacology
VPAC1 VIPR1 Human VIP and PACAP B1 pIC50 5.1 5.1 5.1 Guide to Pharmacology
VPAC2 VIPR2 Human VIP and PACAP B1 pEC50 9.4 9.4 9.4 Guide to Pharmacology
VPAC2 VIPR2 Human VIP and PACAP B1 pIC50 7.2 7.2 7.2 Guide to Pharmacology